SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|348285|fgenesh1_pg.C_scaffold_5001677 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|348285|fgenesh1_pg.C_scaffold_5001677
Domain Number 1 Region: 61-134
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000011
Family B3 DNA binding domain 0.012
Further Details:      
 
Domain Number 2 Region: 3-54
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000608
Family B3 DNA binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|348285|fgenesh1_pg.C_scaffold_5001677
Sequence length 150
Sequence
MTELPRFFKVFIPETSSEALAIPLSFTEHLVDPLPEKAKFQGAGGRFWTVSLTKLCGVLV
KNRIHELLIPAKVVKEHKLTLGKRLYYIDEHGSLKGKKAKYKDGRTCRYIGFDKITKRNS
LKAGDTITCNLLHTRKLVHSVRIHINHRAP
Download sequence
Identical sequences D7LTZ4
jgi|Araly1|348285|fgenesh1_pg.C_scaffold_5001677 59689.fgenesh1_pg.C_scaffold_5001677 XP_002876108.1.15461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]