SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|350906|fgenesh1_pg.C_scaffold_6001499 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|350906|fgenesh1_pg.C_scaffold_6001499
Domain Number 1 Region: 14-118
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.67e-20
Family B3 DNA binding domain 0.0052
Further Details:      
 
Domain Number 2 Region: 215-305
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.28e-20
Family B3 DNA binding domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|350906|fgenesh1_pg.C_scaffold_6001499
Sequence length 308
Sequence
MVRNGVFGQVMEERDNPAFFKILRREDFSSEMMRMIPHHLIRSISDKSSSFKMVLRVPWG
SSWQVKISKNPIFHYMEDRGWNQFVNDNGLGLNEFLTFTHEANMCFNVTIFEADGTEMLR
PRQPSTIASSSGRNKREEKKSIYIDVKKEEEIESWSESSYAGHKTAESTSGRLKQKQELN
LRKKEADKTEKSKKRKKKKVDTVCNDSEAGTSSLVPEFKLTIKKSHLLFLGIPKKFVDMH
MPSETKMFKIHHPRGKKSWEVWYVVNDVQSRFSGGWSRLAKELGLVVGDVCTFELIKPTE
MCVKVSKE
Download sequence
Identical sequences D7LXQ0
jgi|Araly1|350906|fgenesh1_pg.C_scaffold_6001499 59689.fgenesh1_pg.C_scaffold_6001499 XP_002873865.1.15461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]