SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|353664|fgenesh1_pg.C_scaffold_7000837 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|353664|fgenesh1_pg.C_scaffold_7000837
Domain Number 1 Region: 205-304
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.1e-21
Family B3 DNA binding domain 0.01
Further Details:      
 
Domain Number 2 Region: 574-673
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.51e-20
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 3 Region: 700-798
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.24e-18
Family B3 DNA binding domain 0.0071
Further Details:      
 
Domain Number 4 Region: 8-95
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000569
Family B3 DNA binding domain 0.0075
Further Details:      
 
Domain Number 5 Region: 450-533
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000102
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 6 Region: 92-173
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000106
Family B3 DNA binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|353664|fgenesh1_pg.C_scaffold_7000837
Sequence length 912
Sequence
MANPLSSSQSNRPFFVRSLAGHNSNLIIPDAFFTAHLKDKTGLTKLKLTSDASDRTWDVK
LNGRRFAGGWDDFSAAHCLRDDDVLVFRHDGKMSFSKHFSRTNGLTKRWCVIDLMNLSGE
SWALGLRHNNRTGQDYIRGHWRSFCRANEMKPGSSYRFKLVRNGTRPLLRLCSEVIPEGN
RSRANGKDNVSEKYSRAAGSASTKQNKFLTVTFKHYMIQSGHLRLPRSFARENGIKEAEE
IILVDKNGVKWPSYVASAKQRGEFYMAHGWKRFCEANKLNTGDTFTLEFVRGEDTTPMLK
FCSKAKVKIEQEEAPEETETPFQKRARVSAEVGHSRRTQTPNKASHDPKILQRKQPLQPC
SFSDQAKKVKQSIVNILTGIKRFRSELEIKEQSLEAALLEIDALVLNINRGESIGNQQNP
QVIIKSRSEVKIRKWNMNFCKPCLYLELVQQSRQMIPAEFFSTYVEGKNQSTKLKLTSDA
LDRTWEVKLNGRRFARGWENFSTVHSLQDDDVLIFREIGDMTFHVTASGRSFCKVQYISS
DEDGADEDDAWTEYSDSKNIASKKKPRTEAKSSSKNSYLVAHVTSSNLSRDRLSLIKGFA
RSNGLNQRCCEIDLMNQHGKSWTVGLRYSTANEQASISGGWRDFCLANGLEAGSFYRFKL
VQNGARPLLRLCSETIPEEDCYKGNRKEIFSESASMKQSKFLTMTFKPYMLKSGQLHISR
PFAIENEIKEAEDITLVDKNGGNWPSYVASGDGQGGKYYLAKGWRGFCAANRLKTGETFT
LEFVRGESTTPMLKFCSKTKIEQVPLDEERETQEETETRVEKRARVSAGGGSSRRNQASN
KPNADPQNLKPRQPPCSISDRVQKVKQIIEDTLTGVKRIRSELEVKEQNLEASILEIDAL
GEKVLEINKILK
Download sequence
Identical sequences D7MB45
jgi|Araly1|353664|fgenesh1_pg.C_scaffold_7000837 59689.fgenesh1_pg.C_scaffold_7000837 XP_002867289.1.15461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]