SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|355494|fgenesh1_pg.C_scaffold_7002667 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|355494|fgenesh1_pg.C_scaffold_7002667
Domain Number 1 Region: 7-105
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.9e-17
Family B3 DNA binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 368-463
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-17
Family B3 DNA binding domain 0.0052
Further Details:      
 
Domain Number 3 Region: 250-329
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000334
Family B3 DNA binding domain 0.021
Further Details:      
 
Weak hits

Sequence:  jgi|Araly1|355494|fgenesh1_pg.C_scaffold_7002667
Domain Number - Region: 139-187
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0726
Family B3 DNA binding domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|355494|fgenesh1_pg.C_scaffold_7002667
Sequence length 499
Sequence
MANSMFSSSAKPHFLKPILPGFKTYILIPKAFYSKYLEGRQEGNAAELRSDASEITWNIK
IDGRRMTKGWEEFAVGHNLQVGDILVFRHEGNLLFHVTPFGLSCCEILYSQNDEKVVKDK
TGKVTRYKTVKKTAKNECSSVDTDFVYLPRGFTTSSGLSKLCNEIILMDEKSRPSTLKLC
YHKSRKPPVLRIYPLERDEDNIGNHSKKIKQEVEHETVKEETNVESGKLKRDGLLKKDPQ
KVCSSSHDTIFVVPGTASNQRNDSFHLPKGFTTSSGLSKLCKKIIFMDEKDNRFTVRRGW
RGFCCRNGHKTGCFLRLILVRNGKTPVLRIFPLEKDESSIGKNSKEIKQEVEHESAKEEK
NVESLSLSDNSSFVVSVTVSNLREDILYLPIRLSRSNILDKKFHEISLMNKQGRTWTLSL
KYSKSSGKFRITHGWKSFCEANGQNAGCTFLFNLVRNRTSPVLLMTSLWDDIHQSKTASF
DNSVGPRRSSMGQEVKIMG
Download sequence
Identical sequences D7MHL0
59689.fgenesh1_pg.C_scaffold_7002667 jgi|Araly1|355494|fgenesh1_pg.C_scaffold_7002667 XP_002870396.1.15461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]