SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|481325|fgenesh2_kg.4__385__AT2G24650.1 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|481325|fgenesh2_kg.4__385__AT2G24650.1
Domain Number 1 Region: 1356-1455
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.28e-20
Family B3 DNA binding domain 0.0066
Further Details:      
 
Domain Number 2 Region: 1249-1346
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.34e-20
Family B3 DNA binding domain 0.0085
Further Details:      
 
Domain Number 3 Region: 127-223
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.93e-20
Family B3 DNA binding domain 0.0082
Further Details:      
 
Domain Number 4 Region: 924-1020
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.37e-19
Family B3 DNA binding domain 0.0069
Further Details:      
 
Domain Number 5 Region: 798-896
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.26e-18
Family B3 DNA binding domain 0.0089
Further Details:      
 
Domain Number 6 Region: 657-742
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.49e-18
Family B3 DNA binding domain 0.0084
Further Details:      
 
Domain Number 7 Region: 261-357
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.46e-18
Family B3 DNA binding domain 0.0041
Further Details:      
 
Domain Number 8 Region: 1503-1604
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.53e-17
Family B3 DNA binding domain 0.007
Further Details:      
 
Domain Number 9 Region: 385-466
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-17
Family B3 DNA binding domain 0.0069
Further Details:      
 
Domain Number 10 Region: 5-98
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.29e-16
Family B3 DNA binding domain 0.0049
Further Details:      
 
Domain Number 11 Region: 1046-1134
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-16
Family B3 DNA binding domain 0.0098
Further Details:      
 
Domain Number 12 Region: 1139-1222
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000049
Family B3 DNA binding domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|481325|fgenesh2_kg.4__385__AT2G24650.1
Sequence length 1609
Sequence
MATFYPQFFHTLVPSFLTHFMIPEDFFLKYIEGTSFAELKSDVSDRTWKVKMSDRRITDG
WEDFVVANDFRIGDVVVFRYVGDLVFHVSNLGPNYSEIQDNEEVPREKKAKTNSGEAEAV
SSSSSADNSCFVALITALNLTIDTLYLPLHFTSSNGLTRKNSEIVLTDGGERSWVLDLRF
DESSHTFYISRGWRNFCDENGQKAGDFFMFKLVGNGEKLVLSFQNIAREDSKDECSSLDS
LMDIEKKKYSAKRRGSPYSSYSPSHKQFVTFTLPPDYARIGRLSLSAPFVRENGINKPGE
ICLLDKHGRKWLTNLLLDSKGTMSLGKGWKDFVKANSLETGFTLKLKWEETTPVLSLCYA
ESNSDREQEEFSKAIEKRSLFMDTKYLPPHFTSSNGLTRKCHKIVLRDGGERSWELDLKF
NESSDTFYISQGWRNFCDENGQKAGGFFMFKLVGNGETLVLSFRPTKSINDGRQRYCSEA
SRRESVATKLSSEEENITWEGSKDECSTLESLMEKEKKKYSLKPRGSPHSSYSPCHKRFV
TFTLPPDYARIGRLVSLSETTLDSISFDACLFGFCSNIYRVFRHRSLGRMALTSLVRYFF
WINMVEGDTSNRDKINNNENNKDESRSWERKKNHPKWRDSTPSTQKQYVTLTITPFRRLS
KIFTRENDINKPGKITLLGKDGIKQQTNLLFDKTNGSMSLGSGWKDFVKDNGLKTGDSFT
LKLIWEDQTPVLSLCPAECSIDREAGGTNQKKSLPIEPSICTKVSKDVNIKEKNNKEESR
SVDRERNHLRETDVTPSSQKHVVTLTITPSSVKRDRLILSAQFARENNINKPGTIYLLDR
DGTKSLINLQQDKRGTMSLGKGWKEFAEANDIKLGESFMMKLVWEGTIPMLSLLRTEFSS
SKANKKESISSEPKSRDSSPIIKNRFVTPALTPEDVKSCKLILTAQFARENNINKPGTLY
LLDRDGTKWLTTVKRDNKGTMSLGNGWKEFAETNDLKLGDSFRMELIWEDTTPILSLLRT
KFSSSKSNKEESISSEPKSRDSSQTIENRFVTLALTPEDVKACKLILPSQFMKANGISNK
LGKITLLGENKVEWPGYLLSRDGTVALGNGWEGFCEANGVKLGHSFTLEFVNEQDTTPTI
PVVFFLKHIEGRDDQKMAELRSDASKITWKVKIDGQRLTDGWKEFALAHDLRIGDIVIFR
QESDLSFHVTLLGPSCCEIQYGSCLDEETNLEKKKNPNGEAETSSLGRSCFVAKVAPSSL
SYDSMHLPRPFVRENGVVTGSGEIVLMNEKGRSWKLKLRQKPSCGTVYVKGGWVSFCDAN
GLRAGDIYTFKLIQRGGTLVLRLLPNEEAESSSLDPSCFVANVAPSSLRYDTLYLPRRFM
RENGLDKRCGKMILMNEKGKSWTLDLKQKKSCGTSLIKRGWSSFCRANGLRAGSIITFKL
IKKGGNLVLRLLTNEPKEEDECSEANEVESLSTDQESNEESHDEKISRRKEKKGNLMWKA
SSSPSENRFVTLTLTPYNILRSVLRLPIPFTRMNGINEDTKMTLLDKHGTKWLTTLRLVD
YKSKRLRMAGGWQGFIQANCVKANESIMLELIWEEDTSCILKFCSKVKL
Download sequence
Identical sequences D7LIB2
59689.fgenesh2_kg.4__385__AT2G24650.1 XP_002880604.1.15461 jgi|Araly1|481325|fgenesh2_kg.4__385__AT2G24650.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]