SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|496153|fgenesh2_kg.8__1969__AT5G60140.1 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|496153|fgenesh2_kg.8__1969__AT5G60140.1
Domain Number 1 Region: 8-107
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.04e-19
Family B3 DNA binding domain 0.00043
Further Details:      
 
Domain Number 2 Region: 192-286
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000106
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|496153|fgenesh2_kg.8__1969__AT5G60140.1
Sequence length 291
Sequence
MNHGNYSDGSTSKFFKPYLPSESGDDLMLPIYFNSCLPKPLPETVNVRSIYGKVWKLVLR
KCGGEVERFVMVNGWKKIVRDEDLKGGDLLAFEFDGSRCFNLCIYERETMCKKLKRSSEQ
SEEIIEVGSDGEEETLASDDSDDSDNDYAVEDDDVAEDDDGLEDEDEVEAEDDDDVKAED
DDDNDERQYLDHHNNPYFTMTLNPKKKSQLHIPAYVIKDYDLNFPARITVMDQLGALEKA
IKIQKNGSIFVKGFGSVIRRNKMKMTDKMICELKRTGSNLVHTIKVNIISG
Download sequence
Identical sequences D7MT69
jgi|Araly1|496153|fgenesh2_kg.8__1969__AT5G60140.1 59689.fgenesh2_kg.8__1969__AT5G60140.1 XP_002866372.1.15461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]