SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|857250|Al_scaffold_0007_749 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|857250|Al_scaffold_0007_749
Domain Number 1 Region: 20-114
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-20
Family B3 DNA binding domain 0.0021
Further Details:      
 
Domain Number 2 Region: 224-320
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-19
Family B3 DNA binding domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|857250|Al_scaffold_0007_749
Sequence length 339
Sequence
MEESCEDCMKWEEELYWTHFQTLHFTQLLLPGFHYRLAIPQKFSTHCKRKLPQIVTLKSP
SGATYSVRVEEDDEKTLAFGFGWDKFVKDHSLEENDLLVFKFHGLSEFEVLVFDGQTLCE
KPTSYFVRKCGHAEKTKVSQTGYEQEEHINPDIDTASAQLPVISPTSTVRVSERKYHPLS
SFKKMRGEISNDNLDQKTDVEMISAGSNNRALSLAKGAISPDGFLVFMRRSHVLSKCFLT
IPYKWCVKNMLMARQEVVMQVDQRKWDMKFNFFGARGSGGISTGWKKFVQDNNLREGDVC
VFEPANSVTKPLHLNVYIFCGEETERSKNVDSVHTISSE
Download sequence
Identical sequences D7M8S6
59689.Al_scaffold_0007_749 jgi|Araly1|857250|Al_scaffold_0007_749 XP_002867189.1.15461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]