SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|858253|Al_scaffold_0007_1752 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|858253|Al_scaffold_0007_1752
Domain Number 1 Region: 106-243
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.7e-38
Family B3 DNA binding domain 0.0027
Further Details:      
 
Domain Number 2 Region: 517-598
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000000422
Family PB1 domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|858253|Al_scaffold_0007_1752
Sequence length 637
Sequence
MGGGEYLYDELWKLCSGPLVDVPQAQERVYYFPQGHMEQLEASTQQVDLNTMKPLFVLPP
KILCNVMNVSLQAEKDTDEVYAQITLIPVGTEVDGPTSPDPSPPELQRPKVHSFSKVLTA
SDTSTHGGFSVLRKHATECLPPLDMTQQTPTQELVAEDVHGYQWKFKHIFRGQPRRHLLT
TGWSTFVTSKRLVAGDTFVFLRGEKGELRVGVRRANRQQSSMPSSVISSHSMHLGVLATA
RHATQTKTMFIVYYKPRTSQFIISLNKYLEAMSNKFSVGMRFKMRFEGEDSPERRYSGTV
IGVNDCSPHWKDSKWRCLEVHWDEPASISRPNKVSPWEIEPFVTSENVPKSVMLKNKRPR
QVSEVSALDVGGITASNLWSSVLTQSHEFAQSCITSQWSSPQQCHRDANEDAKKSDWINN
SYSVSNVSKDSTLNDQMVSPVEQKKPETTTNYRLFGIDLMSSSLAASEEKTAPMRPINIS
KPTMDSHSDPKSEISKVSEEKKQEPAEGSPKEVQSKQSSSTRSRTKVQMQGVPVGRAVDL
TALKGYNELIDDIEKLFDIKGELQSRNQWEIVFTDDEGDMMLVGDDPWPEFCNMVKRIFI
WSKEEVKKMTPGNQLRMLLTEVETTLTTASKTDNHTN
Download sequence
Identical sequences D7M8Z2
XP_002869750.1.15461 59689.Al_scaffold_0007_1752 jgi|Araly1|858253|Al_scaffold_0007_1752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]