SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|861370|Al_scaffold_0006_879 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|861370|Al_scaffold_0006_879
Domain Number 1 Region: 15-120
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.12e-20
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 205-300
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.22e-18
Family B3 DNA binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|861370|Al_scaffold_0006_879
Sequence length 301
Sequence
MASNPDFLWCKEERKQESFVKLLKHFDMSSENTRAIPYDFVRNFSDNELSGNMKIRVQWG
NSWKVKISKNPRFYFMEKSGWETFVRDNALGDYEFLTFTHKGKMSFTVNIFNKDGKEMMQ
PPQSRAFLASSSRIKTEQDVKREEVLVSSDSSSRGPTTAAVSNGNGEGMYKRKLNFGKKK
AEETQNSKRTERVVSRQRVYAGAPSSSVAEFNIFISKSYIKSLAIPTTFANDYMPKEKTM
VKIHHPDGKKSWNVAFVVKKKGHIFSGGWKCLCREYPVVFGDTCKFTLIKPYELLLAVSR
P
Download sequence
Identical sequences D7M272
XP_002873422.1.15461 59689.Al_scaffold_0006_879 jgi|Araly1|861370|Al_scaffold_0006_879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]