SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|868325|Al_scaffold_0004_488 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|868325|Al_scaffold_0004_488
Domain Number 1 Region: 677-775
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.3e-20
Family B3 DNA binding domain 0.017
Further Details:      
 
Domain Number 2 Region: 261-355
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.83e-20
Family B3 DNA binding domain 0.0099
Further Details:      
 
Domain Number 3 Region: 384-479
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.12e-17
Family B3 DNA binding domain 0.0061
Further Details:      
 
Domain Number 4 Region: 530-628
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.87e-16
Family B3 DNA binding domain 0.016
Further Details:      
 
Domain Number 5 Region: 122-207
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000196
Family B3 DNA binding domain 0.013
Further Details:      
 
Domain Number 6 Region: 7-47
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000216
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|868325|Al_scaffold_0004_488
Sequence length 777
Sequence
MEASLLRRNTGGMCLGKGWKEFAMSNGLKSGESFTLEAILENGTPMLGLFSTQSRSDRSQ
QGEYSKHSEKESIFVEHSSGKETRKAIINRDVRRDSYPASRNPFVTLRLTYDNLRNSRRV
SSSINPLIQRNLPLSFTRENGLDEPGIITLVGNDGTKLEANLLRENTGIMCLGKGWKEFA
MSNGLRSGELFTLEAILENGIPMLSLVSTQSTRYRSQEGECAKDSEKESISTVPSKGNKK
RKATSKREEKRDSSSASQNRFVTFTPEDIRDCILYLPQDLTALIGLERKCREIVVTDERE
RSWALELKFNKSSDTFYISRGWRSFCDENDKKAGGVFVFRLVGNRETPVLSFCSTESIKN
NKENCMELERKKKHLKCIDSTSPSQNRFVTLSLSHDNLRTGTRHLPLSFARDNGLDKPGI
ITLVDKDGTKRKANLRREKTGKMFLGKGWKDFVIANGLKSSKSFTLEAVLENGTHMLSLV
SIQSTSDRSQQGECSKDSKKELISAVPSRGNKTRKAMNNRDVRRDSFPASQNQFVTLSLS
HDSLRKGRQYLPLSFTRENGLDEPGIITLVSKDGTKLEASLLRENKGIMCLGKGWKEFAI
ENGLKTGELFTLEAILEKGTPMLSLLSTESTSDRSQQGECSKDSEKESISAEPSKENKKK
KATSNREERRDSSSAIQNRYVTLTLTPEDVSACKLILPSQFMKANGINKLGKITLVGQNR
TKWFAYLLSKNGIVALGSGWKGFCEANGVKTGESFTLEYIDEQDTTPVFKFWSNSVE
Download sequence
Identical sequences D7LIB4
jgi|Araly1|868325|Al_scaffold_0004_488 XP_002880605.1.15461 59689.Al_scaffold_0004_488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]