SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|881733|Al_scaffold_0001_3500 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|881733|Al_scaffold_0001_3500
Domain Number 1 Region: 119-235
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.1e-27
Family B3 DNA binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 509-588
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000726
Family PB1 domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|881733|Al_scaffold_0001_3500
Sequence length 625
Sequence
MENNEELNAQPELLGIIDRTQTYMYEQLWKICAGPLCDLPKPGETIYYFPQGHIELIEAS
TKDELDQIRPHFDLPSKLRCCVDDIQLKIDQNTDDVYAEIYLMPDTTDVITPITTMDNQR
PMVYSFSKILTSSDANTHGGLSILKRHATECLPPLDMSQRTPMQHLVAKDLHGREWTFKH
SFRGTPRRHLFTSGWSLFATTKRLIVGDAFVFLRGENGELGVGIRRARHQLGHKPSLVIS
TQCMKDGVIASVVNAFKSKCKFIVVYKPSSSQFVVNYDKFVDAMNNKFIVGSRFRMRFEG
QDFSEKRYSGTIIGVNDMSPHWKDSEWRSLQVQWDELSPFPRPDKVSPWEIEHLIPSSSI
SQPTVLQKKRARQCNEIGSTSSNLLTGQEIGQSSLSSPKSVPEFSCRDAVEDSKFPSDWL
MSDLVPAIPKPNNNNNQLVQQTKEKITTEATTSCILFGVDLTKASKTKDPMGPIEATETT
TSCILSQDKKLDQTLTWTSPKEVQSSKFNSTRRRIKVQMQGVVIGRAVDLTVFHGYNQLI
QKLEELFDLKDELRSRNQWEIVFINNEGNVMPLGDDPWPEFCNMAKKIFIGSKEEIEKMK
SRNKVSQAKSTVLTSSSDVPPNVKA
Download sequence
Identical sequences D7KJF3
jgi|Araly1|881733|Al_scaffold_0001_3500 XP_002893812.1.15461 59689.Al_scaffold_0001_3500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]