SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|901025|scaffold_400526.1 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|901025|scaffold_400526.1
Domain Number 1 Region: 78-180
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000108
Family B3 DNA binding domain 0.016
Further Details:      
 
Domain Number 2 Region: 232-318
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000114
Family B3 DNA binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|901025|scaffold_400526.1
Sequence length 333
Sequence
MMFNVSACGLGELPTPSNNKIGNISRKQHQRLRTEEGDDQDKTVVLGRGKRIRKNNSQSE
ASSSSSNKSNLNEDVLGDKKSFITLKLTNDGHKKSRVGLPLPFMRANGLNKPGEIGMLAK
DGKKLMVNLLKDVNGRMSLGRGWRDFALVNGFQIGESITLELIWRDSNPMFRFSSTGTDS
ECDQRQGEYCSQACEEEPICIEPSGNRDKKEKNNIEDKKYSSLETLNRVLTLTLKPKDVK
DCNLVSSSNKILPSEFMRAYGIDKHMTITILGKANMKWWGYPSSRDGTIAVGIGWANFCK
ANGIETGNLFTLELVSEEVDTSPMFRICPNSGD
Download sequence
Identical sequences D7LIB6
jgi|Araly1|901025|scaffold_400526.1 59689.scaffold_400526.1 XP_002880607.1.15461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]