SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|901028|scaffold_400529.1 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|901028|scaffold_400529.1
Domain Number 1 Region: 45-147
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.06e-20
Family B3 DNA binding domain 0.0076
Further Details:      
 
Domain Number 2 Region: 158-250
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-16
Family B3 DNA binding domain 0.011
Further Details:      
 
Domain Number 3 Region: 305-400
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000171
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|901028|scaffold_400529.1
Sequence length 410
Sequence
MFNVSACDIRDKPSPSNIEIKKLVLLEREKKVRKINSQSEASTSSSDNSSFVALVKASNL
EEDTLYLPQDCTRSNGLNRKCRKIVLTDGGSRSWEMELKFKKNLGSFYITRGWRHFCDEN
GKKAGSFFVFELTIKEGTPLLYFSPSESTINYTKLPTQKRFVTVRVVPDCLKRCRLYLSR
RFLKNNGLGETKMVTLLGTDGTRRLANLVRETSGRMSLGRGWVEFVKANGLKIGQYFTLE
SIWANDSPILKLSSTNDSKSDKRKHRENFPVASHKEFVSTEASDGNEPEKDMNTEEMINQ
SSLIDNRFVILALEPEDAKAGMLYLPSHFMKANGIDKIGKIYMLGTNEMEWWWGNLLTRD
GIVSVGCRWRYFCKSNGVKIGQYFKLEYMYKYDTRPVLKFVPSPGSKSYV
Download sequence
Identical sequences D7LIB9
XP_002880608.1.15461 59689.scaffold_400529.1 jgi|Araly1|901028|scaffold_400529.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]