SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|901333|scaffold_400834.1 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|901333|scaffold_400834.1
Domain Number 1 Region: 460-525
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000314
Family B3 DNA binding domain 0.01
Further Details:      
 
Domain Number 2 Region: 27-71
Classification Level Classification E-value
Superfamily F-box domain 0.0000432
Family F-box domain 0.0083
Further Details:      
 
Weak hits

Sequence:  jgi|Araly1|901333|scaffold_400834.1
Domain Number - Region: 235-392
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.0719
Family Tricorn protease domain 2 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|901333|scaffold_400834.1
Sequence length 529
Sequence
MAEPEIEKMTSSVSKLQLSPPPSVRKEKTFSMPDWSLLPEELLNLISKHLEDYCFDVVHA
RSVCTLWRSIFPFPASLLRPSYSLPSLTKFPYESKDLCTLEKIPLFLFRVRAPHADASEY
FLGGIGRDDDDHIELPSPLQCSVKVKIPDSDPTLINTLDCQVLSLGHQYRMIGCNPKYYK
GVAFLPLNKFGGGEEFVVLLNYTKTLLVLRSIEMRWMLLEIPSYGSCSDLITFRGRFYAA
FSNHDIFAIDPYSLEATPLMPSEALLDCGSVNDLVPSGNDELFLVEKIIPRTGVIYLYRL
TLRLSRLDEEAGKWVEVSEIGDRLLVIGNLGNVCCSAKELPDGCGLTGNSIVFTHGRKVT
YSYKYGVHTGREEDDLNCWRYSRDKCVTILSTSPVVALRKVKDLGILRMAKQHFFKPLLP
GFYSHLIDGQRLTDGWKEFALSHDLLTLLFSDKREICVSTLQCWDLVVVRFNMTLPIPFT
KVNGIQNAKKMSFLDKHGVKWSTSLRLEKDRQRMRLVGGWKEFCDVKIG
Download sequence
Identical sequences D7LCS6
jgi|Araly1|901333|scaffold_400834.1 XP_002880759.1.15461 59689.scaffold_400834.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]