SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|901447|scaffold_400948.1 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|901447|scaffold_400948.1
Domain Number 1 Region: 127-224
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.2e-20
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 3-101
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.88e-20
Family B3 DNA binding domain 0.003
Further Details:      
 
Domain Number 3 Region: 259-333
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000129
Family B3 DNA binding domain 0.014
Further Details:      
 
Weak hits

Sequence:  jgi|Araly1|901447|scaffold_400948.1
Domain Number - Region: 335-458
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0654
Family Galactose oxidase, central domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|901447|scaffold_400948.1
Sequence length 535
Sequence
MANQHFFKPLLPGFHSHLTIPVAFFFKNIEGRNEQKTAELRSDASNKTWKVKIDGQRLTN
GWRDFALAHDLRIGDIIVFRQERDMTFHVTMLGPSCCEIQYVSCLDNQNNRGTIQRKKKK
AESSLDLSCFVANVTPSNLRYDSLNLPMCFVRANGLDNRCGEMILINEKGRSWTVALKRK
KSCATTYIRRGWRNFCNANGLRAGSFFTFKLIERGGTLGLRLAHRELEEEGNAIDNNQDK
RSSRECTKKKILIWKASSLPSQNRFVTVTLTPYNVGQSKLWSTNLWFEEKCKRMRLSGGW
KEFCYANGVKIGESIILEFLWEADRSSVLKFCSKDPRVFNTDEMRWMLLEKPSYASCSDL
ITFRGRFYAAFFNHGIFAIDPYSLEVTPLIPSELLNSGSVNDLVPSGNDALFLVEKIIPR
TGVLYFSRLTLRVSMLDEEAGKWVEVSEIGDRLLVIGDLGNVCCSAKELPDGCGLSGNSI
VFTHGPGNVTYSYKYGVHTGREEDDLNCWRYSREKPVTILSTSPVVALRVESAKL
Download sequence
Identical sequences D7LE94
XP_002880815.1.15461 jgi|Araly1|901447|scaffold_400948.1 59689.scaffold_400948.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]