SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|909307|scaffold_601364.1 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|909307|scaffold_601364.1
Domain Number 1 Region: 520-642
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.89e-19
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|Araly1|909307|scaffold_601364.1
Domain Number - Region: 428-495
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 0.051
Family Chloroperoxidase 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|909307|scaffold_601364.1
Sequence length 685
Sequence
MSYASLSVKDLTSLVSRSGAGSSSSLKPPGQTRPVKVIPLQHPDTSNEARPPSIPFDDIF
SGWTAKVKRMRLVDWVDTLFPCFRWIRTYRWSEYFKLDLMAGITVGIMLVPQAMSYAKLA
GLPPIYGLYSSFVPIFVYAIFGSSRQLAIGPVALVSLLVSNALGGIADTNQELHIELAIL
LALLVGILECIMGLLRLGWLIRFISHSVISGFTSASAIVIGLSQVKYFLGYSIARSSKIV
PLVESIIAGADKFQWPPFLMGSLILVILQVMKHVGKAKKELQFLRAAAPLTGIVLGTTIA
KVFHPPSISLVGEIPQGLPTFSFPRSFDHAKTLLPTSALITGVAILESVGIAKALAAKNR
YELDSNSELFGLGVANILGSLFSAYPATGSFSRSAVNNESEAKTGLSGLITGIIIGCSLL
FLTPMFKYIPQCALAAIVISAVSGLVDYDEAIFLWRVDKRDFTLWTITSTTTLFFGIEIG
VLVGVGFSLAFVIHESANPHIAVLGRLPGTTVYRNIKQYPEAYTYNGIVIVRIDSPIYFA
NISYIKDRLREYEVAVDKYTNRGLEVDRINFVILEMSPVTHIDSSAVEALKELYQEYKTR
DIQLAISNPNKDVHLTIARSGMVELVGKEWFFVRVHDAVQVCLQYVQSSNLEDKKLSFTR
RYGGSNNNSSSSNALLKEPLLSVEK
Download sequence
Identical sequences D7M5U1
XP_002873617.1.15461 59689.scaffold_601364.1 jgi|Araly1|909307|scaffold_601364.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]