SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|912952|scaffold_700694.1 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|912952|scaffold_700694.1
Domain Number 1 Region: 10-101
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.49e-21
Family B3 DNA binding domain 0.00053
Further Details:      
 
Domain Number 2 Region: 274-360
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000432
Family B3 DNA binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|912952|scaffold_700694.1
Sequence length 373
Sequence
MAATDFVFPPRFFKVFVSHFTSDSMMLPIAYYGHLPSRLHKTVILRGPGGCSWNVATTIN
EKEVHFSQGWAKFVEDNTLSDGDILTFVYNGDHVFEVSIYRGYDACKEISAVTEVEEDKE
DSVFSLSSEDNDTCSQSVMKNTIPEGRDKGKSKVEVVGDPDDEEDSVYSASGEETETDTD
SEFQVAKTTIPKSKKKGKKKEQVVESSDEDSDSDSDYIETFGQLDIEENSNSEEDSSYAP
DDEGTSTCVKPKVANVKRKVEPKIKNPETYLDDPKNIHFETNVKNRLYELLVHAQLVKDY
CLKFGDHVYYIDRIGKLKAKTAKWKDQRVCIKKWMRICDRNELKKEDRILCELLRKGTFV
YAIKLHIIRGKNL
Download sequence
Identical sequences D7MF20
jgi|Araly1|912952|scaffold_700694.1 XP_002869150.1.15461 59689.scaffold_700694.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]