SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|913118|scaffold_700860.1 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|913118|scaffold_700860.1
Domain Number 1 Region: 210-451
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.89e-21
Family WD40-repeat 0.013
Further Details:      
 
Domain Number 2 Region: 533-601
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000471
Family B3 DNA binding domain 0.014
Further Details:      
 
Domain Number 3 Region: 439-510
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000216
Family B3 DNA binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|913118|scaffold_700860.1
Sequence length 641
Sequence
MDEAGRMRRHDETMTLIKNYLEQHGMSSTVQANNTIPTVDVENQRERVVQYVKSLIEQDL
NVRSMFYPTVIEGQSRLQTLLEQSVNWQHRDCVHSPLFASLLNDHHCTPQPLHQNHQTLA
TNNLDMQASSSGLGNYDPMLLEFNGQPQHSAGSHYSPSLYLTIEDDTVMPGWTINSDQSA
GFSNDIPSVVTVPPTFSLSDSVVKDIHVTEVVTAFEFHHHLPLVLAVGFSEGLVHTYNYI
HEQRPKPHLEIEAHSGPVNDIVFYSSQGELKIVTCGNDRHIKAWNSSNGLVYWKLTHTAP
LNSLALHQDGNKVQLFILDVFGTAMKPNIGYNGPLDSNPLLFPSDMNARLELKFSGDGKR
LFCYGPGGLVEVDRESFETRRNYNSVMNPQTKCMDICKNGYIAVGDEYCVKVWNVDSDHL
FRKIKIDAAVFPECPMVKFNREGSLLAVVSSLWRRWTIKLAKNISSAVFYIRLGWENVCS
VNGLSEGELCKFKLFQNGERPVLWLCPGEPGIGHKQKRTLDEVSKGKEKNTPSRESTGQL
SLPMSFTRKNNINKAGEVILLNQDGRKWSSYLQITGLGRAGSEWFYLRRGWREMCEANGV
KGKGNQSTRKKRACETAPQPKNVKKAPRVGVEGRLNKRISC
Download sequence
Identical sequences D7M9A5
XP_002867207.1.15461 59689.scaffold_700860.1 jgi|Araly1|913118|scaffold_700860.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]