SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|913300|scaffold_701042.1 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|913300|scaffold_701042.1
Domain Number 1 Region: 9-109
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.04e-22
Family B3 DNA binding domain 0.0028
Further Details:      
 
Domain Number 2 Region: 145-246
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.65e-21
Family B3 DNA binding domain 0.005
Further Details:      
 
Domain Number 3 Region: 271-368
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.37e-16
Family B3 DNA binding domain 0.0098
Further Details:      
 
Domain Number 4 Region: 543-616
Classification Level Classification E-value
Superfamily HRDC-like 0.000000000000959
Family HRDC domain from helicases 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|913300|scaffold_701042.1
Sequence length 632
Sequence
MANASPLSRTNPHFFQPLLPGFDSHLNIPVKFFSDHIKGKHEGKTVNLRSDASERTWKVK
MEGNRLTKGWKEFVKAHDLRVSDFVVFRHEGEMLFNVTALGPSCCEIQYAQPRRHEEDEE
SNETEISLRSEKEVEENVKTESDQSSPNLNCFSRSVTASNLSRDTVGFPINFAKQNGLNK
ERQEIFLMNGEGKTWESELKRWGDCRLSIVRGWTSFCTANKLEVGDSCTFRLLQKTAETP
VFQLCSSTKSERKIQSAEGCIDDKTGGSRFVKLTPTLNSLHVGKQHLPVSFTRENRLINP
GKIVLVDKNRAEWLMELKVDKSTGLMYIISGNGWKKFCAANEISAGESLILELIRGGVTP
LLKFISKLDQPPFEAEAQAHKRARVQKLSQETEPKLDMREKTAEDRVPPRASNKSSGNQE
NLQHTQPCSVSNQLAKVKQSVVDALTSIRRFRAELDTTEQKLEISLQEINKLGMICIAIF
TFNFGSTRFSKNFGTERTEDNGNKTTTSSKPGATLAKDPLASEKQSTLPLPTKDGLPIDI
NLSFNIYTAVRKLRTALAREGPDGVMAYQIFMNSTLQQISRQIPRTKEELLQINGLVQAK
VSKYGDRLLETIETTVNEYYGTKKKDPIIIHQ
Download sequence
Identical sequences D7MB41
59689.scaffold_701042.1 jgi|Araly1|913300|scaffold_701042.1 XP_002867286.1.15461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]