SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|913734|scaffold_701476.1 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|913734|scaffold_701476.1
Domain Number 1 Region: 873-1024
Classification Level Classification E-value
Superfamily SET domain 1.44e-44
Family Histone lysine methyltransferases 0.012
Further Details:      
 
Domain Number 2 Region: 195-302
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.38e-16
Family PWWP domain 0.003
Further Details:      
 
Domain Number 3 Region: 589-653
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000532
Family PHD domain 0.0084
Further Details:      
 
Domain Number 4 Region: 393-456
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000175
Family PHD domain 0.0037
Further Details:      
 
Weak hits

Sequence:  jgi|Araly1|913734|scaffold_701476.1
Domain Number - Region: 696-730
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0213
Family PHD domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|913734|scaffold_701476.1
Sequence length 1024
Sequence
MIIKRKFKTQIPSLHHSGNESRKKRKSNLGGCYYPLNLLGEIAAGIVPGNGRNGFSASWC
NEVSCSMKPVEVEELISKRRSDSGAVRDPPPAEVSRPPLVRTSRGRIQVLPSRFNDSVLD
NWRKDSKSDCDLEEELECRDDKVVSFRVPKASNLKSKELYRNSKYSALCKEARFHEQRNE
ARARVDEKLPNKQGTFGPENFYSGDLVWAKSGRNEPFWPAIVIDPMTQAPELVLRSCIPD
AACVVFFGHSGNENERDYAWVRRGMIFPFVDYVARFQEQSELQGCKPGNFQMALEEAFLA
DQGFTEKLMHDIHLAAGNPTFDDSFYRWIQETAVSNQDLNNNAPTQGLLKKHRNPLACAG
CETVISSEMAKKMKALIPGDQLLCKPCSRLTKSKHICGICKKIRNHLDSQSWVRCDGCKI
WIHAECDQISDKHLKDLGETDYYCPTCRAKFNFDLSDSEKQNSKSKLGKGDGQMVLPDKV
IVVCAGVEGVYFPRLHLVVCKCGSCGPKKKALSEWERHTGSKSKNWKTSVKVKSSMLALE
DWMMKLAELHANATAAKVPKRPSIKQRKQRLLAFLSETYEPVNAKWTTERCAVCRWVEDW
DYNKIIICNRCQIAVHQECYGARHVRDFTSWVCKACERPDIKRECCLCPVKGGALKPTDV
ETLWVHVTCAWFQPEVCFASEEKMEPAVGILSIPSTNFVKICVICKQIHGSCTQCCKCST
YYHAMCASRAGYRMELHCLEKNGQQITKMVSYCAYHRAPNPDNVLIIQTPSGAFSAKSLV
QNKKKGGSRLISSIREDNEESPAEDTITRDPFSAARCRVFKRKINSKKRIEEEAIPHHTR
GPRHHPSAAIQTLNTFRHVPEEPKSFSSFRERLHHLQRTEMDRVCFGRSGIHGWGLFARR
NIQEGEMVLEYRGEQVRGSIADLREARYRRVGKDCYLFKISEEVVVDATDKGNIARLINH
SCTPNCYARIMSVGDEESRIVLIAKANVAVGEELTYDYLFDPDEAEELKVPCLCKAPNCR
KFMN
Download sequence
Identical sequences D7MDQ4
XP_002869532.1.15461 59689.scaffold_701476.1 jgi|Araly1|913734|scaffold_701476.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]