SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for BDCG_04521T0 from Ajellomyces dermatitidis ER-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BDCG_04521T0
Domain Number 1 Region: 36-153
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 9.02e-31
Family Prokaryotic phospholipase A2 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) BDCG_04521T0
Sequence length 166
Comment | BDCG_04521 | Blastomyces dermatitidis ER-3 secretory phospholipase A2 (167 aa)
Sequence
MKTTFLLTLCSMGAFTLSAPTAAAPAGGDLSILTARAETPRQATDRLLFSSTMAQFTAAR
NKKRPSSLNWRSDGCSKSPDKPGFNFLPSCYRHDFGYRNYKAQGRFSKANKKKIDKLFRS
DLYKECAKEKNKEKEENCKDIADIYYWAVSTFGKRDLGENFSLADF
Download sequence
Identical sequences A0A179UDD0 C5GIE5 F2TLI3
BDBG_01510T0 XP_002628602.1.14838 BDCG_04521T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]