SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319954872|ref|YP_004166139.1| from Cellulophaga algicola DSM 14237

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319954872|ref|YP_004166139.1|
Domain Number 1 Region: 215-409
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.99e-67
Family B3/B4 domain of PheRS, PheT 0.00000872
Further Details:      
 
Domain Number 2 Region: 44-202
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.16e-42
Family Myf domain 0.004
Further Details:      
 
Domain Number 3 Region: 481-701
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.93e-29
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0021
Further Details:      
 
Domain Number 4 Region: 711-808
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.1e-26
Family Anticodon-binding domain of PheRS 0.0011
Further Details:      
 
Domain Number 5 Region: 417-489
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000238
Family Domains B1 and B5 of PheRS-beta, PheT 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319954872|ref|YP_004166139.1|
Sequence length 808
Comment phenylalanyl-tRNA synthetase subunit beta [Cellulophaga algicola DSM 14237]
Sequence
MKISYNWLKQFLQISWEAEQTAELLTDLGLEVEGIEAFESTKGGLKGIVVGHVLSCEKHP
NADKLKITSVDIGAENPIQIVCGAANIAQGQKVPVATIGTKLYTKEGEEWTIKKGKIRGE
ESHGMICAEDEIGLGESHDGIMVLSDELIAGTPCSTIFEVENDTVFEIGLTPNRADAMSH
LGVARDLKAGLKQKDIQLELITPSISNFHITNRSLKIDVDVLNNKLAPRYAGITINNLTV
QESPNWLKNRLKAIGLNPINNIVDVTNYVLHELGQPLHAFDANKIKDNKIKVTTLATGTK
FKTLDGVEIELHEDDLMICDAEKPLCIAGVYGGLNSGVTKDTTSIFLESAYFDPISVRKT
SKRHGFNTDASFRFERGIDINSVEYCLKRAAILIQQIAGGDITSDIIDLYPNKEKDYQVF
LTYKKINRLIGQEIPQDIIKSILASLDIKLNNVTETGLGLTIPFYRVDVRREVDVIEEIL
RVYGYNNINFKEKLNASVATTSPFEDYKIQSIIGDFLAAKGFNEIMTNSLTSPIYNEQLE
KLKEEHTVKIINPLSNDLSVLRRTLLFSGLEAISYNSNRKRQNLKFFEFGKSYHNYSGQQ
EENKHLVLFLTGNKNEGSWIAPAAKTSFFTLKSNVESILDRLGIKNLSTVISKSDDFSEA
IAMKSGKTEIVNLGTVKKSILKSFDLKNEILYADFKWDEILTLIKDQKIGYKEISKFPEV
KRDFALLINNEVSFEDIHNIAFETEKTILKEVSLFDVYTGSKLPKGKKSYAVSFTLKSEK
ATLTDKQIEKIMSKFKQNFETKLGAELR
Download sequence
Identical sequences E6X6S8
WP_013552093.1.33206 gi|319954872|ref|YP_004166139.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]