SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319952102|ref|YP_004163369.1| from Cellulophaga algicola DSM 14237

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319952102|ref|YP_004163369.1|
Domain Number 1 Region: 5-199
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.06e-55
Family G proteins 0.00028
Further Details:      
 
Domain Number 2 Region: 151-297
Classification Level Classification E-value
Superfamily Translation proteins 1.61e-29
Family Elongation factors 0.0057
Further Details:      
 
Domain Number 3 Region: 396-509
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.93e-27
Family EF-G/eEF-2 domains III and V 0.0083
Further Details:      
 
Domain Number 4 Region: 300-385
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.0000000000000815
Family EF-G/eEF-2 domains III and V 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319952102|ref|YP_004163369.1|
Sequence length 599
Comment gtp-binding protein typa [Cellulophaga algicola DSM 14237]
Sequence
MSATKNIAIIAHVDHGKTTLVDKIMYHCQLFRENQNTGDLILDNNDLERERGITITSKNV
SVVYKDTKINIIDTPGHADFGGEVERVLNMADGVLLLVDAFEGPMPQTRFVLQKAIDLGL
KPCVVINKVDKENCTPEEVHEKVFDLMFELGAEEWQLDFPTVYGSAKNNWMSDDWKNETT
NIEPLLDMVIEHIPTFEPKEGTTQMLITSLDFSSFTGRIAIGRLLRGDLKEGQQVSLVKR
DGSIVKTKIKELYTFEGLGRLRVEEVETGDICAIVGLEGFEIGDTVADIESPEGLKTIAI
DEPTMSMLFTINDSPFFGKDGKFVTSRHIKDRLARELEKNLALRVNDTDSADKFLVFGRG
VLHLSVLIETMRREGYEMQIGQPQVIIKEIDGVKCEPVEQLTIDLPEEVSGRAVEMVSMR
KGEMTSMEAKGNRMICEFLIPSRGIIGLRNQLLTATAGEAIMSHRFLEYQPMRGDIPQRQ
NGSLVSMEMGKAIPYSIDKLQDRGKFFVEPGEDIYEGQVIGENSRGDDMSVNITKTKKMS
NVRSSGADDKAKIVPAIKFSLEEALEYIQKDEYVEVTPKFIRLRKIYLTENERKRNKIA
Download sequence
Identical sequences E6XBN6
WP_013549366.1.33206 gi|319952102|ref|YP_004163369.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]