SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319952945|ref|YP_004164212.1| from Cellulophaga algicola DSM 14237

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319952945|ref|YP_004164212.1|
Domain Number 1 Region: 2-201
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.78e-58
Family G proteins 0.00013
Further Details:      
 
Domain Number 2 Region: 164-284
Classification Level Classification E-value
Superfamily Translation proteins 1.48e-26
Family Elongation factors 0.0095
Further Details:      
 
Domain Number 3 Region: 400-495
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.98e-21
Family EF-G/eEF-2 domains III and V 0.025
Further Details:      
 
Domain Number 4 Region: 291-369
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.66e-18
Family EF-G/eEF-2 domains III and V 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|319952945|ref|YP_004164212.1|
Sequence length 598
Comment gtp-binding protein lepa [Cellulophaga algicola DSM 14237]
Sequence
MKNIRNFCIIAHIDHGKSTLADRLLDFTGSVTEREKKEQLLDTMDLERERGITIKSHAIQ
MEYTYKGEEYILNLIDTPGHVDFSYEVSRSIAACEGALLIVDAAQSIQAQTISNLYLALE
NDLKIIPVLNKIDLPSANPEEVTDDIVDLLGCDPSEVIPASAKTGIGIEEILAAVIERIP
APKGNPDESLQALVFDSVYNPFRGVETYFRVINGEIKKGQKIKFVATDSDYYADEVGTLK
LTQHPKQSVKTGDVGYLITGIKDAREVKVGDTITDAASPTKNAIEGFEDVKPMVFAGIYP
VDTDEFEELRASMEKLQLNDASLVFAPESSAALGFGFRCGFLGMLHMEIIQERLEREFNM
TVITTVPNVSYNAYTRKNPTEALIVNNPTDLPDPSSIDRVEEPYIKATIITKADYVGNVM
SLCIEKRGLITNQTYLTTERVELNFDMPLAEIVFDFYDRLKTVSKGYASFDYTPIGMRVS
KLVRVDILLNAQPVDALSALIHADNAVNIGKRMCEKLKELIPRQQFDIPIQAAIGSKVIS
RETTKALRKDVTAKCYGGDISRKRKLLEKQKKGKKRMRQVGNVEVPQEAFMAVLKLND
Download sequence
Identical sequences E6X8W9
WP_013550196.1.33206 gi|319952945|ref|YP_004164212.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]