SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|556573892|ref|YP_008742422.1| from Burkholderia pseudomallei NCTC 13179

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|556573892|ref|YP_008742422.1|
Domain Number 1 Region: 4-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 3.38e-108
Family FMN-linked oxidoreductases 0.00000000104
Further Details:      
 
Domain Number 2 Region: 334-523
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 7.65e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000556
Further Details:      
 
Domain Number 3 Region: 463-521,557-651
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.01e-19
Family C-terminal domain of adrenodoxin reductase-like 0.0000475
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|556573892|ref|YP_008742422.1|
Sequence length 673
Comment NADH:flavin oxidoreductase / NADH oxidase family protein [Burkholderia pseudomallei NCTC 13179]
Sequence
MTFYPHLTAPLELGFTSLKNRVLMGSMHVGLEEAANGFERMAAFYAERARGEAGLIVTGG
IAPNERGRMMPGGSMLTTEEEAERHRIVTRAVHDAGGRIAMQILHFGRYAYHPALVAPSA
LKAPINTFTPHALSASEVDATIDDFARCAALAQYAGYDGVEIMGSEGYLINEFIAAHTNH
REDEWGGAYENRIRFPVEIVRRVRERVGTNFIIIYRLSMLDLVEGGSTLDEVIRLAQAIE
AAGATILNTGIGWHEARIPTIATKVPRAAYAWVTKRLVGRVGIPLVATNRINTPEIAEQL
LAEGYCDMVSMARPFLADAQFVRKAREGRADEINTCIGCNQACLDHIFSGRITSCLVNPR
ACHETELVIEPAERRKRIAVVGAGPAGLSFAVTAAERGHDVELFEASPEIGGQFNIAKKV
PGKEEFHETLRYFRRQLELRGVTLHLNTRADVARLAGGGFDEIVLATGVTPRRPDIEGIG
HARVMGYLDVLRDGKPVGASVAVIGAGGIGFDVSEYLTHTGESASVAPSTFYAQWGIDVD
YGARGGVRMPHVEAAPRNVHLLQRKASKVGDGLGKTTGWIHRTSLKARRVAMSSGVSYER
IDDAGLHVRIDSEPRTLAVDNVVVCAGQEPQRELYDGLRAAGCSVHLIGGAHVAAELDAK
RAILQGTTLAASI
Download sequence
Identical sequences gi|556573892|ref|YP_008742422.1| WP_009976746.1.18549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]