SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320449768|ref|YP_004201864.1| from Thermus scotoductus SA-01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320449768|ref|YP_004201864.1|
Domain Number 1 Region: 1-268
Classification Level Classification E-value
Superfamily Folate-binding domain 1.88e-97
Family Aminomethyltransferase folate-binding domain 0.000000268
Further Details:      
 
Domain Number 2 Region: 267-347
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 1.37e-19
Family Aminomethyltransferase beta-barrel domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|320449768|ref|YP_004201864.1|
Sequence length 349
Comment glycine cleavage system T protein [Thermus scotoductus SA-01]
Sequence
MKKTPLYQAHLRHGGRMVEFAGYALPLQYTSIVEEHLAVRRGAGLFDVSHMGEFLIRGRE
ALAFLQWATANDAAKLKVGRAQYSMLPNARGGVVDDIYLYRLAEEEYLMVVNAANIAKDF
AHLKELSRGFAVELTDLSEETALLALQGPKAASLLQGLTDADLSQRKKNDVFSARVAGRP
ARLARTGYTGEDGFELFLAPKDAEAVFEALLEAGATPAGLGARDTLRLEAGFPLYGHELT
DDTNPLCTPWAWVVKKEKDFHGKEAMLATPCAEKLIGLVLEAGIPREGYRVYSGDRPVGR
VTSGGYSPLLEKGIALAYVEKGAQEPFFVEVRGRKAGASLSPLPFVPLK
Download sequence
Identical sequences E8PMN9
WP_015716596.1.74984 gi|320449768|ref|YP_004201864.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]