SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320450250|ref|YP_004202346.1| from Thermus scotoductus SA-01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320450250|ref|YP_004202346.1|
Domain Number 1 Region: 114-188
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 1.05e-17
Family Siroheme synthase middle domains-like 0.0013
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00000000000000167
Family Siroheme synthase N-terminal domain-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320450250|ref|YP_004202346.1|
Sequence length 216
Comment siroheme synthase 1 [Thermus scotoductus SA-01]
Sequence
MTYFPLMLNLRDRPVLLIAGGPETGAKLQALLEAQAQVTVLAEEDHWNLADLAKEGRIRW
LPRGYREGDLEGFFLVVSHPRDKGIHPQVKAEAERRRVFLVAVDDPENATAILPAVVRRG
ELVVALSTSGAAPALAVRLKERFLRLLGPEYGELVAYLRRLRPRIAEIPCFEERKRLWYR
LVDLALEELDLDPEAGLTRAKEKVEEVLAEVQPWTR
Download sequence
Identical sequences E8PQD8
gi|320450250|ref|YP_004202346.1| WP_015717074.1.74984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]