SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313122609|ref|YP_004044536.1| from Halogeometricum borinquense DSM 11551

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313122609|ref|YP_004044536.1|
Domain Number 1 Region: 17-94
Classification Level Classification E-value
Superfamily gp5 N-terminal domain-like 1.09e-22
Family gp4 N-terminal domain-like 0.0037
Further Details:      
 
Domain Number 2 Region: 84-246
Classification Level Classification E-value
Superfamily Phage fibre proteins 0.000000267
Family Tail-associated lysozyme gp5, C-terminal domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313122609|ref|YP_004044536.1|
Sequence length 247
Comment hypothetical protein Hbor_38660 [Halogeometricum borinquense DSM 11551]
Sequence
MTHPDLFGAEQSGDDGIRGVAVGIVTDNQDPKDLGRVKLQFPWRDADDESYWARIATEMA
GKEYGTYFLPEVEDEVLVAFENGDIHKPFVIGSLWNGKQKPPQKNSDGKNNTREIRSRSD
HKIAFDDADKGSITIQTSAGNEIAIDDSGDSETIVVRDEKNDNSIAIDSGSGSVKIDAKK
EIELSAQNIKINGKKSVDISGNKGVKVQSKGQMKLSSKAKLDIKSSGLMSVNATGPLQIK
GAIIQLN
Download sequence
Identical sequences E4NVW0
WP_006053416.1.71935 WP_006053416.1.94995 gi|313122609|ref|YP_004044536.1| gi|313122609|ref|YP_004044536.1|NC_014736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]