SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313125027|ref|YP_004035291.1| from Halogeometricum borinquense DSM 11551

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313125027|ref|YP_004035291.1|
Domain Number 1 Region: 31-340
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 4.32e-104
Family Adenylation domain of NAD+-dependent DNA ligase 0.000000242
Further Details:      
 
Domain Number 2 Region: 425-601
Classification Level Classification E-value
Superfamily RuvA domain 2-like 1.71e-54
Family NAD+-dependent DNA ligase, domain 3 0.0000999
Further Details:      
 
Domain Number 3 Region: 343-420
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.6e-24
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00072
Further Details:      
 
Domain Number 4 Region: 611-686
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000000632
Family DNA ligase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|313125027|ref|YP_004035291.1|
Sequence length 694
Comment NAD-dependent DNA ligase [Halogeometricum borinquense DSM 11551]
Sequence
MRDGGKLAYADPDNPYLTDPDTDFEPVESLSAEAAEREARLLREAVREHDHRYYVAADPL
VADRTYDALFNRLQELEDAFDLDDESSPTRRVGGEPLDELDTVEHVAPMLSIDQSVEAAD
VRDFDRRVREAVGEVRYVCEPKFDGLSVEVVYEDGEYVRAATRGDGERGDDVTAQVRTIR
SIPLRLRGDYPDFLTVRGEVYMPRDAFQELNRERIEADEEPFANPRNAAVGTLRQLDPSV
TADRPLDCFFYDVLDASDVPETQTATLSRLDSWGLRTNDRVESVADIDGAIAYRDELMAA
REDLNYEIDGTVIKVDRRDQREQLGETSRSVRWAFAYKFPARSEVTTMTDVVVQVGRTGR
LTPVALLDPVDVGGVTVSRASLHNPEEIERLGVNIGDEVRIKRAGDVIPDVEEVVEKHSE
GTFDFPEECPVCGSPVNREGPLAYCTGGLTCEAQLVRAVDHYAMRGALDIEGLGGERVEQ
LVDEGLIEGLPDLYRLERDELSELEGWGKTSADNLVTEIEATKSPELSSFLVGLGIPEVG
GSTARNLARAFGSLDAVMDASVEELEEVEDVGPTVAEKIREFFDTESNRKAIAEMRSLGV
EPETAETAGGDELDGLTFVFTGSLAVTRGDAQELVQAHGANATSSVSGNTDYLVIGDNPG
QSKRDDAAANDVPVLDEDEFAELLAEKGIEYPPE
Download sequence
Identical sequences E4NSW4
gi|313125027|ref|YP_004035291.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]