SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313125229|ref|YP_004035493.1| from Halogeometricum borinquense DSM 11551

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313125229|ref|YP_004035493.1|
Domain Number 1 Region: 15-68,208-406
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.79e-46
Family Bacterial dinuclear zinc exopeptidases 0.01
Further Details:      
 
Domain Number 2 Region: 78-163
Classification Level Classification E-value
Superfamily PA domain 0.000000000000314
Family PA domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313125229|ref|YP_004035493.1|
Sequence length 441
Comment aminopeptidase [Halogeometricum borinquense DSM 11551]
Sequence
MDNHNKERNAALGRAWTDDESWDFLTRLTRIGNRMGGSNGERRAATLVAEAFRDAGVCDV
HTDPFEMQAWSRGRSRLSLEADGRAFDTVALPYSPSGDVTGELVYVGHGTPDEVDEHDVA
GKIVVASTTTPPGGRFVHRMEKFGYAIDAGAEAFVFVNHVPGQLPPTGALKFGEEAVAPA
VGVSKESGAWLKDDAEDGTMARLTVEAETTTGESQNVVGRLGPDTDEEILLLAHYDAHDI
AEGALDNGCGIAVVVTAARILAQFDLSVGVRIAGVGCEETGLTGSEHLAEQLAHDRIKAV
VNVDGAGRFRDLIAMTHTSEATASVAERVADETRHPIQIETEPHPFSDQWPFARAGVPAL
QLHSDSGERGRGWGHTHADTRDKVDDRNIREHAMLTALLVAELAGEDEVPRLDTEELAAA
FRDAGFETGMRAADLWPDAWE
Download sequence
Identical sequences E4NLF8
WP_006055379.1.71935 WP_006055379.1.94995 gi|313125229|ref|YP_004035493.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]