SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313126488|ref|YP_004036758.1| from Halogeometricum borinquense DSM 11551

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313126488|ref|YP_004036758.1|
Domain Number 1 Region: 252-507
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 1.7e-62
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000108
Further Details:      
 
Domain Number 2 Region: 13-154
Classification Level Classification E-value
Superfamily Globin-like 2.45e-27
Family Globins 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|313126488|ref|YP_004036758.1|
Sequence length 562
Comment methyl-accepting chemotaxis protein [Halogeometricum borinquense DSM 11551]
Sequence
MDNQGLAVTDANRRTVDGSELAATMGLDDEEIAWRKSFNRFGAEDVERLESLSPLFDGIA
EDVVDDFYDQLTSDENSNEIIGRSSKGLDALKRDQIAYLKSLGSGEYGKQYFERRARVGK
IHDMLDVGPKFYLGAYSIYYENLIEAIGADVKQEFSGSSDDTDGLFAQLRSSTADGDVDD
AVDAVVDRSISLLKLFLLDQQVAMETYIHSYSQEAREQAERRRQLTTQVQRELREPIDEV
HQSSLTVTERAEDIRDIATEQVEDMEAVAGEISQMSATVEEIAATAEEVENTSLEAAERA
SKGETAANEAIEVMQEVSQAATEASEDVRRLQTKIDEVDEVIETINDIAEQTNLLALNAS
IEAARAGEAGEGFAVVAEEVKSLAEQSQEQASEVEQTVNSVQSEAGETVESLTETTEKLH
EGIELGGEAMSSLSEIVEAVERTTEGIAEVADATDNQAMSAEQVTGAVENTREQAKNVAS
QVDEVADASREQTNQIKAIRESSKRLDMGNGGESASSDGTPTSADTEPPLSSVGTDGGVD
EMPESVRQAEGSGDEPSNPSDE
Download sequence
Identical sequences E4NMA8
gi|313126488|ref|YP_004036758.1| WP_006054856.1.71935 WP_006054856.1.94995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]