SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313126561|ref|YP_004036831.1| from Halogeometricum borinquense DSM 11551

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313126561|ref|YP_004036831.1|
Domain Number 1 Region: 1-162
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.44e-32
Family GHMP Kinase, N-terminal domain 0.00025
Further Details:      
 
Domain Number 2 Region: 172-321
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.59e-31
Family Mevalonate 5-diphosphate decarboxylase 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313126561|ref|YP_004036831.1|
Sequence length 324
Comment diphosphomevalonate decarboxylase [Halogeometricum borinquense DSM 11551]
Sequence
MKATAKAHPIQGLVKYHGMRDEELRLPYHDSISVCTAPSHTKTTVEFQPDASEDTYVIGG
EEVTGRGAERIDAVVEHVRSLADIDHAVRLESENSFPSNIGFGSSSSGFAAAAMALAEAA
ELGMSRPEISTIARRGSSSAARAVTGAFSHLYSGMNDEDCRSERIETELEDELRTVAAHV
PAYKETEQAHKEAADSHMFQARMAHVHHQLDEMRDALHAADFDRAFELAEHDSLSLTATT
MTGPAGWVYWQPKTIAVFNAVRELRDEEEIPVYFSTDTGASVYVNTTEAHVDRVEEAISA
CDVDTDVWGVGGPAEILDESEALF
Download sequence
Identical sequences E4NMX4
gi|313126561|ref|YP_004036831.1| WP_006054926.1.71935 WP_006054926.1.94995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]