SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313126851|ref|YP_004037121.1| from Halogeometricum borinquense DSM 11551

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313126851|ref|YP_004037121.1|
Domain Number 1 Region: 4-119
Classification Level Classification E-value
Superfamily Globin-like 3.81e-35
Family Truncated hemoglobin 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313126851|ref|YP_004037121.1|
Sequence length 125
Comment hypothetical protein Hbor_21120 [Halogeometricum borinquense DSM 11551]
Sequence
MSDQTLYRRLGGRDALASVVDTFYDRILADDELRPFFEDVDMTKQRAHQTQFLSAVAGGP
VEYDGENMAAAHEHLDITHEEYDAIAAHLDAALEIHDVPADDRETVLTAVESFRDDIVTI
DASPA
Download sequence
Identical sequences E4NPK6
WP_006056869.1.71935 WP_006056869.1.94995 gi|313126851|ref|YP_004037121.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]