SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313127116|ref|YP_004037386.1| from Halogeometricum borinquense DSM 11551

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313127116|ref|YP_004037386.1|
Domain Number 1 Region: 7-61,200-402
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.67e-47
Family Bacterial dinuclear zinc exopeptidases 0.0056
Further Details:      
 
Domain Number 2 Region: 67-193
Classification Level Classification E-value
Superfamily PA domain 0.00000000000811
Family PA domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313127116|ref|YP_004037386.1|
Sequence length 435
Comment aminopeptidase [Halogeometricum borinquense DSM 11551]
Sequence
MTDWIGKTFTSDFGWDHLESLVDIGDRMAGSPGEREAMELTRDALEAAGARNAHIDTFEI
QGWERGDSRVVTDGTTQDCIALPRSPSDASSGEFVDLGYGLPEDFEADLSGKVVMVSSTV
PDHYERFIHRREKYYHAVEAGAEAFVFANHVEGCLPPTGSVGTEESPVGDIPAVGVSKEV
GTRLARRFEGEAVTVEVDCETPPAESGNVHAELGPDTEDELLVTSHLDAHDIAEGAWDNG
SGTAMVVELARILAEREDELETRVRFIAFGAEEVGLVGSGHESDRLGDEREHIKAVVNND
GVVFGRTLKFDTHGFDALEAAAESVGDQFDHPVSIVPELVPHSDHWPFTQWGVPGYMISC
ETAGRGRGWGHTFADTLDKLEVRNLREQAILLAQLVVDLADDEMEIQHKDEAEIIEALEE
EDHAAGMKITGDWPY
Download sequence
Identical sequences E4NRA0
gi|313127116|ref|YP_004037386.1| WP_006056603.1.71935 WP_006056603.1.94995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]