SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313125773|ref|YP_004036043.1| from Halogeometricum borinquense DSM 11551

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313125773|ref|YP_004036043.1|
Domain Number 1 Region: 13-260,348-404
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.89e-55
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0000664
Further Details:      
 
Domain Number 2 Region: 236-344
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3.59e-29
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00013
Further Details:      
 
Domain Number 3 Region: 426-506
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00000000288
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|313125773|ref|YP_004036043.1|
Sequence length 521
Comment l-aspartate oxidase [Halogeometricum borinquense DSM 11551]
Sequence
MSESTTETGADARETDVLVVGSGIAGCAAALAAARSGANVLVATKATAPEDASTDWAQGG
IAVTGEDPETFREDVLDASDGTADPEAVDILVGDARDAVEDVLVDTIGVPFDGAPAGAGL
DDYDHGREAAHSERRILHVNASTGGHVLRPFLNHLRDHDGVTFLEDAMALDFLTHEGRVH
GVHLLREGSVEPVFAGATVLATGGIGACYGTTTNPDGATGDGVAMAAFAGARIADMQYVQ
FHPTAYPGDDPFLVSEAVRGEGAVLRNGEGERFMPGVHDDAELAPRDVVARAVKDERDRT
GEVRLDVSPVEPDFRTEFPDLAELCDERDVDPEDGIPVAPAEHYLCGGIAVDERGRTTLD
RLFAAGECARTGVHGANRLASTSLLEGLVWGLRAGETAADAGADAAERIETQEPLDSDPE
LPDEFASAKYARLRETMDSAVGVERTHADLEQARSTIRRLKGEVDAYTRTRVSRSLYELR
NATVCALLVARAASEAPSAGCHHVVDADAEGSANGGARADD
Download sequence
Identical sequences E4NPW5
WP_006053823.1.71935 WP_006053823.1.94995 gi|313125773|ref|YP_004036043.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]