SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320102896|ref|YP_004178487.1| from Isosphaera pallida ATCC 43644

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320102896|ref|YP_004178487.1|
Domain Number 1 Region: 15-95
Classification Level Classification E-value
Superfamily Pili subunits 9.42e-23
Family Pilin 0.017
Further Details:      
 
Weak hits

Sequence:  gi|320102896|ref|YP_004178487.1|
Domain Number - Region: 188-226
Classification Level Classification E-value
Superfamily AF1862-like 0.0523
Family Cas Cmr5-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320102896|ref|YP_004178487.1|
Sequence length 369
Comment hypothetical protein Isop_1353 [Isosphaera pallida ATCC 43644]
Sequence
MRSSSPRAHLARHGFTLIELLVVIAIIAVLIALLLPAVQSAREAARRAQCVNNLKQIGLA
LHNYESANSVFPWTQGKTGGLFPQWTNGLFPWEPGYDGFGHEWATWSAHTLMLPFMEQTA
AYNAINFSFGANWYTPKPNTHDPCQLTAINFTIASFLCPSDGRGVGRNNYMASNGTNFDW
HSRAGGAGLLTRASSFPSTIAAVTDGLSNTIAFSERPRGDGNNTQYSPGDVYNAVPIHVR
FLNSPTAYIMQTPDMQAALPGAIAECDQFARSNPFSTWDWSGFYWASGNYNQTIFNFVLT
PNHRSRDCSPWGGVATGFGFFTPRSYHPGGVNCLFGDGSVKFIKDSINPMAWYALGTRQG
GEVVSADMF
Download sequence
Identical sequences E8QX97
WP_013564226.1.76794 gi|320102896|ref|YP_004178487.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]