SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320103686|ref|YP_004179277.1| from Isosphaera pallida ATCC 43644

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320103686|ref|YP_004179277.1|
Domain Number 1 Region: 4-149
Classification Level Classification E-value
Superfamily AF1862-like 1.96e-24
Family Cas Cmr5-like 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320103686|ref|YP_004179277.1|
Sequence length 157
Comment Cmr5 family CRISPR-associated protein [Isosphaera pallida ATCC 43644]
Sequence
MAIMYDKDRAADAWKRVREIASKDEELQKRYRSQVRSGPAMIQRSGLGQFLAFLASKGFE
NGDQEVKGKEGANAQLYRHLTCWVAKALGHDPDNRLRPENIAPGRSQNGQFDLLAFLLNS
STTLEQTMHATTEALAWMRWARRFADSQLTMPEANDE
Download sequence
Identical sequences E8R4C7
WP_013565016.1.76794 gi|320103686|ref|YP_004179277.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]