SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336063464|ref|YP_004558323.1| from Streptococcus pasteurianus ATCC 43144

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336063464|ref|YP_004558323.1|
Domain Number 1 Region: 4-81,174-352
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.26e-58
Family Bacterial dinuclear zinc exopeptidases 0.00000944
Further Details:      
 
Domain Number 2 Region: 71-182
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 9.01e-26
Family Aminopeptidase/glucanase lid domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336063464|ref|YP_004558323.1|
Sequence length 355
Comment glutamyl aminopeptidase [Streptococcus pasteurianus ATCC 43144]
Sequence
MSELFSKIKEITELDSIAGYEHSVRNYLRSKITPLVDDVQTDGLGGIFGIKNSAAENAPR
IMVAAHMDEVGFMVSDIKADGTMRAVGIGGWNPLVLSSQRFTLYTRDGRAIPVVSGSVPP
HFLRGANGSAALPKIDDIIFDAGFTDKAEAEAFGILPGDIIVPKSETILTANQKNVISKA
WDNRFGVLMVTELLESLKGQKLDNTLIAGANVQEEVGLRGAHVSATKFQPELFFAVDCSP
AGDIYGNQGKIGDGTLFRFYDPGHIMLKDMRDFLLTTAEESGIKYQYYAAKGGTDAGAAH
LKNGGIPSTTIGVCARYIHSHQSLYAMDDFLQAQAFLQAIVKKLDRSTVDLIKKY
Download sequence
Identical sequences A0A135YRD8 A0A2I1YER5 E0PB61 F5X497
gi|336063464|ref|YP_004558323.1| WP_003062933.1.44928 WP_003062933.1.54516 WP_003062933.1.58062 WP_003062933.1.70423 WP_003062933.1.78385 WP_003062933.1.88220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]