SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336063505|ref|YP_004558364.1| from Streptococcus pasteurianus ATCC 43144

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336063505|ref|YP_004558364.1|
Domain Number 1 Region: 3-82,178-341
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 9.32e-54
Family Bacterial dinuclear zinc exopeptidases 0.000000795
Further Details:      
 
Domain Number 2 Region: 70-183
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 1.36e-29
Family Aminopeptidase/glucanase lid domain 0.00000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336063505|ref|YP_004558364.1|
Sequence length 345
Comment M42 glutamyl aminopeptidase [Streptococcus pasteurianus ATCC 43144]
Sequence
MKTTVDYITKLANIPSPTGYTSHIMNYVIAELESFGYAPVRTNKGGVMVTITGKNDSKHR
VVTAHLDTLGAMVRAVKPDGRLKMDLIGGFVYNAIEGENCTVHVSKNGKKISGTILMHQT
SVHVYKDAGTAERNQTNMEVRLDEKVTNEKETRALGIEVGDFISFDPRVVVTESGFIKSR
HLDDKVSAAILIELLKEYKAQNITLPYTTHFYFSAFEELGHGANSSIPVETVEYLSVDMG
AMGDDQQTDEYSVSICVKDGSGPYHYELRQHLVKLANDNKIPYKLDIYPYYGSDASAALR
AGAEVKHALFGAGIESSHSYERTHIDSVQATERLVDAYLKSPIVE
Download sequence
Identical sequences A0A0W7V2Y6 A0A135YQB9 F5X4D8
gi|336063505|ref|YP_004558364.1| WP_013851416.1.58062 WP_013851416.1.58379 WP_013851416.1.70423 WP_013851416.1.78385 WP_013851416.1.88220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]