SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336063898|ref|YP_004558757.1| from Streptococcus pasteurianus ATCC 43144

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336063898|ref|YP_004558757.1|
Domain Number 1 Region: 11-393
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 1.96e-136
Family ArgJ-like 0.0000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336063898|ref|YP_004558757.1|
Sequence length 397
Comment glutamate N-acetyltransferase/amino-acid N-acetyltransferase [Streptococcus pasteurianus ATCC 43144]
Sequence
MKVIEGNVASPLGFSADGLHAGFKKRKLDFGWIVSEVPASVAGVYTTNKVIAAPLIVTRN
SIKKAQKMKAIVVNSGVANSCTGVQGMEDAYTMQKWTAEKLGVEPDLVGIASTGVIGDLL
PMDTLKTGLSKLVVNGNSDDFSKAILTTDTMVKTVAVTEKFGRDEVTMAGVAKGSGMIHP
NMATMLAFITCDANISSETLQLALSQNVETTFNQITVDGDTSTNDMVLVLSNGCTLNEEI
LPDTPEFDKFSAMLNYVMQELAKKIAKDGEGASKLIEVNVKNAPNALDARMMAKSVVGSS
LVKTAIFGEDPNWGRILAAVGYAGVDVPVDNIDIYLGDIPVMLKSSPVDFEVEEMQDIMH
EDEITITVDLHSGEAVGKAWGCDLSYDYVKINALYRT
Download sequence
Identical sequences A0A135YWA1 A0A2I1YIC9 F5X5I1
gi|336063898|ref|YP_004558757.1| WP_013851616.1.70423 WP_013851616.1.78385 WP_013851616.1.88220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]