SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330833885|ref|YP_004408613.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330833885|ref|YP_004408613.1|
Domain Number 1 Region: 5-444
Classification Level Classification E-value
Superfamily L-aspartase-like 1.73e-120
Family L-aspartase/fumarase 0.0000000407
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|330833885|ref|YP_004408613.1|
Sequence length 456
Comment adenylosuccinate lyase [Metallosphaera cuprina Ar-4]
Sequence
MDVICPIDWRYGSKEMREIFSREGIMNYRIKVELALLNALKTLGYLSEQDLEKVKNVSAL
ITPEEVDKLEEKLGHDVMALVVSMAEKAGDAGKLIHFGATSYDIVDTAYALMFKDALNII
KRKLINSLEKLKEFSIKYENQLMVGRTHGQHAVPTTLGFKFANYLYELTRSLERLLEAEN
RVVLGKISGAVGTMAAWGKDGLKIEELVMKELGLKPHAISTQVAPRDGFAELISDLAIMG
SSMDRFSIEVRELMRPEIGEVAEGVGNRVGSSTMPHKENPVTAEKIGGLAKVLRGLVLSE
MENIPLWHERDLTNSSSERFIISHAFLIIDEMIDSFNELLSNLRINPESMHRNLELSKGL
NMAESLMINLTLKGLPRHKAHEIVSRISREARRSGKSLFETAINDETVMSILTVDEIRRA
LDPLRYLGEYRELIHRSIKAYEHALKRANEIKTVTD
Download sequence
Identical sequences F4G3D1
gi|330833885|ref|YP_004408613.1| WP_013736631.1.2613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]