SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330833892|ref|YP_004408620.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330833892|ref|YP_004408620.1|
Domain Number 1 Region: 3-130
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 3.85e-42
Family Cytidine deaminase 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|330833892|ref|YP_004408620.1|
Sequence length 135
Comment cytidine deaminase [Metallosphaera cuprina Ar-4]
Sequence
MIDPSDEDLIEYALKASKNSYSPYSKIKVGAAILTETNDVITGTNVENASYGLSMCAERV
AVFKAISMGIRKFRKIAIILDDGKGIMPCGACRQVLMEFGKDIIVITKDKDGRLVKFNLD
SLLPNSFTLKGEEIG
Download sequence
Identical sequences F4G3D8
WP_013736638.1.2613 gi|330833892|ref|YP_004408620.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]