SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330833898|ref|YP_004408626.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330833898|ref|YP_004408626.1|
Domain Number 1 Region: 163-417
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.35e-72
Family Aminoacid dehydrogenase-like, C-terminal domain 0.0000122
Further Details:      
 
Domain Number 2 Region: 13-161
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 4.89e-53
Family Malic enzyme N-domain 0.00000726
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|330833898|ref|YP_004408626.1|
Sequence length 428
Comment malate dehydrogenase [Metallosphaera cuprina Ar-4]
Sequence
MVATNFEEMALEVAARYKGKIQMMPKVPVNSLNDFSVLYTPGVAAVSREINKNPDLSFHY
TYRWNSIAIVTDGSRVLGLGDIGPEAAMPVMEGKALIFKFLGGVDAIPLPLGTKDADKII
ETVKTIEPAFGGINLEDIESPKCFYVLEKLKDILQIPVWHDDQQGTAGATLAGLITALEL
SGKAQNNIKIVLFGTGAANIATARLLSKYGIPLKNMVLIDSAGVLYRGRLDEERMKTENP
WKYELLKETNKEDAKTIEDAFKGADVLIAASKQGPGVIRKEWIRLMNTNPIVFALANPIP
EIWPEEAKEAGAVIVATGRSDFPNQVNNSLIFPGVFRGSLDVRAKAITDEMVIEAARELA
SHVRERGIEPDYIIPKMTEWEIYPRVAAAVGTKAIHQNVARVSKSHSELFENAKLLIEKT
RSHMKSIA
Download sequence
Identical sequences F4FXU4
gi|330833898|ref|YP_004408626.1| WP_013736644.1.2613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]