SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330834012|ref|YP_004408740.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330834012|ref|YP_004408740.1|
Domain Number 1 Region: 8-137
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.86e-33
Family Translational machinery components 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|330834012|ref|YP_004408740.1|
Sequence length 137
Comment 30S ribosomal protein S9P [Metallosphaera cuprina Ar-4]
Sequence
MSSETRVIITNARRKMARARCYLYPGKGKIFVNGMPVELLPEEVLRMKIMEPMILAGEGI
TNKVDAKIYMKGGGVMGQADAARMALAKALVRFTGSQELKELYKRYDRTMLAGDPRQTET
EKWMRYSARRWRQKSYR
Download sequence
Identical sequences F4FYD7
gi|330834012|ref|YP_004408740.1| WP_013736756.1.2613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]