SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330834275|ref|YP_004409003.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330834275|ref|YP_004409003.1|
Domain Number 1 Region: 14-136
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000000000000835
Family GHMP Kinase, N-terminal domain 0.0056
Further Details:      
 
Domain Number 2 Region: 176-248
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00000206
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|330834275|ref|YP_004409003.1|
Sequence length 262
Comment shikimate kinase [Metallosphaera cuprina Ar-4]
Sequence
MQAYGGVSIINALPSWYGSSMAIDMKVKVRVWEGKRNSDDKLVNEILDYFASLNVPDLRV
EIESEIPIGSGLKSSSALSTALIGEIAQKFSLKVDVTKLSAILSLKAGVSYTGAFDDAVS
SWYGGISFTYNKEFKLIKTQRASEDMIVLLLARGGKTRVDMSKLRAFRTLFLEFFNIAMS
GRIWEAMKLNGIAVATILGYSSEPIESSLRAGALASGISGNGPSYFAVAKEGEEGPILEA
LEKFGKVKLVRAINLDNRDRTI
Download sequence
Identical sequences F4FZU0
WP_013737017.1.2613 gi|330834275|ref|YP_004409003.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]