SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330834319|ref|YP_004409047.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330834319|ref|YP_004409047.1|
Domain Number 1 Region: 1-276
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 1.39e-70
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.00042
Further Details:      
 
Domain Number 2 Region: 266-480
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 1.44e-41
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|330834319|ref|YP_004409047.1|
Sequence length 493
Comment 4-hydroxyphenylacetate 3-hydroxylase [Metallosphaera cuprina Ar-4]
Sequence
MIRKGADFMKSIKEGHHGEVYYNGEKVNDITESPAFKAAVSTVADYYDLHWKDEYKEYLR
VYNPDVGEETSVTLYRPRNKEELRRLRVGISKIYDFYKGFFGRSPDYLNVWTTLFYAHAE
DYFGKVFGSKMMENVIEIYKEAAKQDLFYTHAIVAPMYDRSRPPSQWEDPYIQVGVVKET
SEGIVVRGAAMLSTAGPYSERLWYLPNIRRDTDPRYAVFFSLPTESKGVKFISRRGFYPK
QEFGEFEYPVTSKYEEPDAILVLDNVFVPWDRVIFYKKPEEIEGFMWHTVNLRGWFNWHF
VIQHYSRTKFLAGLAIAIAEAVGINNFINVQEKIGEILIYLAMYESALVASEELGEQLPG
IYRPNPQISIAISSMGMKALPRINEILRSISAGSSIPVPAGIKDFENPEERALLDRYLAS
KGLPSLERVKLFNLLWDTIGSETGMRYEQYDRFSRGDPTIRWAQMYTEVYRDRKQELIKM
VRDVMDQMPNPKA
Download sequence
Identical sequences F4G064
gi|330834319|ref|YP_004409047.1| WP_013737061.1.2613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]