SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330834355|ref|YP_004409083.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330834355|ref|YP_004409083.1|
Domain Number 1 Region: 75-207
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.22e-20
Family Cytidylyltransferase 0.0079
Further Details:      
 
Domain Number 2 Region: 3-70
Classification Level Classification E-value
Superfamily AF1782-like 2.49e-19
Family AF1782-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330834355|ref|YP_004409083.1|
Sequence length 217
Comment cytidyltransferase-like protein [Metallosphaera cuprina Ar-4]
Sequence
MSDLRDRVVKYIANMEETLKKIEKEDQRVISLAKQYTSDAKFYLEKGDLETALVDIVYAE
GLIDALKIIEGTKEKKVFVGGTFDIIHPGHIEFLRRASSLGRVYVAVSRDKNAERVKGRK
PINDENQRLEVVKGIKYVHEAFLGDENDFLKSVERVRPDIVFLGPDQHVDENKLKEELAK
RGLVVEVARLEQRIDRWKHSSTSSIIKEIADRYCNHA
Download sequence
Identical sequences F4G0A0
gi|330834355|ref|YP_004409083.1| WP_013737097.1.2613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]