SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330834480|ref|YP_004409208.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330834480|ref|YP_004409208.1|
Domain Number 1 Region: 95-347
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 6.58e-71
Family Creatinase/aminopeptidase 0.00000319
Further Details:      
 
Domain Number 2 Region: 12-132
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 0.000000331
Family Creatinase/prolidase N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|330834480|ref|YP_004409208.1|
Sequence length 354
Comment peptidase M24 [Metallosphaera cuprina Ar-4]
Sequence
MRLYKLEKIKEKLNARNLMILGEPNVFYFTGYRGAGGLLDCDGNKVLLAPLLERNRALKV
KGIDVKLYYPFKIDDEVIEGNLTTAMKQICKPSPNDQVLVDVGYVPTEIYIQLNSIYNIK
NITQEILETRAIKDDQEIEMIKLAQRATAEAMKKAGSSLDKDMTEIELAGLIDMTMRREG
AEDYAFPSITAFGENAAEPHHIPTMRSLKSGDTVVVDIGAKYQGYSFDSTRTFLYNCSEK
AKKVYETVLEAQLEAIDTVREGVEASTVDKVARSRIERAGYGKYFVHSTGHGVGIEVHEN
PTISMRSKDLLKEGMVITVEPGIYIENELGVRIEDTLIVRKGKPEVLETVYKAI
Download sequence
Identical sequences F4G134
gi|330834480|ref|YP_004409208.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]