SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330834584|ref|YP_004409312.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330834584|ref|YP_004409312.1|
Domain Number 1 Region: 186-268
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000000785
Family Multidrug resistance efflux transporter EmrE 0.011
Further Details:      
 
Domain Number 2 Region: 43-132
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000418
Family Multidrug resistance efflux transporter EmrE 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330834584|ref|YP_004409312.1|
Sequence length 272
Comment hypothetical protein Mcup_0723 [Metallosphaera cuprina Ar-4]
Sequence
MKWDRGFYNLIGASVLWGTIGVIVQESYKVGATSLGIVLFRTVFSSIITIPYFTRRIFSW
KSIIMGLISGIFYEIYTYTIILDGAPLSSFLLYTSPLFVIIFSYLLFKEKITLVKFIGSA
LVIVALYLNYLGTPTLLELVWGILSGITYAILISFSKYLQMHGFSGWEVLSSQSLWSMLP
TSMSILFLNKVHLLPSALGGVYMAIFGTIIPYYLFYKGIKTFDSTVATIISSLEPVTTTI
LAYFFLNQTLTTFQIIGATIIIISSLWLGILT
Download sequence
Identical sequences F4G1L5
WP_013737326.1.2613 gi|330834584|ref|YP_004409312.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]