SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330834750|ref|YP_004409478.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330834750|ref|YP_004409478.1|
Domain Number 1 Region: 5-253
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 4.51e-74
Family FdhD/NarQ 0.0000951
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330834750|ref|YP_004409478.1|
Sequence length 255
Comment formate dehydrogenase family accessory protein FdhD [Metallosphaera cuprina Ar-4]
Sequence
MQVEKVNLVKIREGEWTRNEDFVAIEEPLEISTCFRECKTFAIVMRTPGDDLELSLGFLY
SEGIIDRYDDVVSVEVRSGTSQIFLKNENKVKSREIVVNSSCGVCGRALLYALEVLRSDV
RIKSDVIFSLPKKLRDGQSAFNVTGGLHAAGLFSTEGEMLYLYEDVGRHNAVDKIVGRLL
MRNELPASSTILQVSGRIGYEIVSKAIMAGIPVVSGISAPTSYAIKIAEDSGITLIGFSR
GESFNVYAHPERIKA
Download sequence
Identical sequences F4G2E6
gi|330834750|ref|YP_004409478.1| WP_013737492.1.2613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]